<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
8LaBV 8LaBV30 U.S. 1994 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 NRTI+IDV 30

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82A   L10I, I62V, L63P, I64V, E65D  
>8LaBV30| 21 | codons 1-99 | clone 21
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIVGIGGFVKVRQYD
QVPVDICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF
>8LaBV30| 22 | codons 1-99 | clone 22
PQITLWQRPVVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIVGIGGFVKVRQYD
QVPVDICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF
>8LaBV30| 24 | codons 1-99 | clone 24
PQITLWQRPVVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIVGIGGFVKVRQYD
QVPVDICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF
>8LaBV30| 27 | codons 1-99 | clone 27
PQITLWQRPVVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIVGIGGFVKVRQYD
QVPVDICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF
>8LaBV30| 30 | codons 1-99 | clone 30
PQITLWQRPVVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QVPVDICGHKAIGAVLIGPTPANIIGRNLMTQLGCTLNF
>8LaBV30| 31 | codons 1-99 | clone 31
PQITLWQRPVVTIKIGGQLKEALLDIGADDTVLEEMNLPGRWKPKMIVGIGGFVKVRQYD
QVPVDICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF
>8LaBV30| 32 | codons 1-99 | clone 32
PQITLWQRPIVTVKIGGQLMEALLDTGADDTVLEEINLPGRWKPKRIVGIGGFIKVRQCD
QIPVEICGQKAIGTVLAGPTPANIIGRNLLTQIGCTLNF
>8LaBV30| 33 | codons 1-99 | clone 33
PQITLWQRPVVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIVGIGGFVKVRQYD
QVPVDICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF
>8LaBV30| 34 | codons 1-99 | clone 34
PQITLWQRPVVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIVGIGGFVKVRQYD
QVPVDICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF
>8LaBV30| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIVGIGGFVKVRQYD
QVPVDICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Zhang, Y-M Drug resistance during indinavir therapy is caused by mutations in the protease gene and in its gag substrate cleavage sites. J Virol, 1997
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005