<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
787_1 787_1 Poland 2009 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, M36I, N37D, R57K, Q61E, L63P, I64V, I93L  
>787_1| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEIDLPGRWKPKMIGGIGGFIKVKQYD
EIPVEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N   V35M, V60I, D121H, K122E, I135T, D177E, T200I, I202V, Q207G, R211K, V245K, D250E, A272P, K275G, K277R, L282C, L283I, T286A, I293V, P294Q, I326L  
>787_1| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRIKVEELRGHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKESWTVNDIQKLVGKLNWASQIYPGIGVRQLCKCIRGAKALTEVVQLTEEAE
LELAENREILKEPVHGVYYDPSKDLLAEIQKQGQG

References
Author Title Citation
Parczewski, M Transmitted HIV drug resistance in antiretroviral-treatment-naive patients from Poland differs by transmission category and subtype. J Antimicrob Chemother, 2014