<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CU61 CU61 Cuba 1999 HIV1 D PBMC None

Treatment History
Order Regimen Weeks
1 AZT NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  T74P K20R, E35D, M36I, N37D, R41K, K43R, D60E, Q61E, L63P, H69Q  
>CU61| codons 1-99
PQITLWQRPLVTIKIGGQLREALLDTGADDTVLEDIDLPGKWRPKMIGGIGGFIKVRQYE
EIPIEICGQKAIGPVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Cuevas, MT High HIV-1 genetic diversity in Cuba. AIDS, 2002