<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
8LaBV 8LaBV6 U.S. 1993 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 NRTI+IDV 6

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, K20R, L63P, E65D  
>8LaBV6| 25 | codons 1-99 | clone 25
PQITLWQRPVVTVKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVPVDICGHKAIGTVLVGPTPVNIIGRDLLTQIGCTLNF
>8LaBV6| 26 | codons 1-99 | clone 26
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVPVDICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
>8LaBV6| 28 | codons 1-99 | clone 28
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVPVDICGHKAIGIVLIGPTPVNIIGRNLLTQIGCILNF
>8LaBV6| 29 | codons 1-99 | clone 29
PQITLWQRPVVTIKIGGQLKEALLDTGADGTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVPVDICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>8LaBV6| 31 | codons 1-99 | clone 31
PQITLWQRPVVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYN
QVPVDICGHKAIGTVLVGPTPVNIIGRNLLTQIRCTLNF
>8LaBV6| 32 | codons 1-99 | clone 32
PQITLWQRPIVTVKIGGQLREALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIDICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>8LaBV6| 33 | codons 1-99 | clone 33
PQITLWQRPVVTVKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPVDICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>8LaBV6| 35 | codons 1-99 | clone 35
PQITLWQRPIVTVKIGGQLREALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIDICGHKAIGTVLAGPTPVNIIGRNLLTQIGCTLNF
>8LaBV6| codons 1-99
PQITLWQRPIVTVKIGGQLREALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIDICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Zhang, Y-M Drug resistance during indinavir therapy is caused by mutations in the protease gene and in its gag substrate cleavage sites. J Virol, 1997
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005