<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CU78 CU78 Cuba 1999 HIV1 F PBMC None

Treatment History
Order Regimen Weeks
1 AZT+ DDC NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G16E, E35D, M36I, R41K, R57K, L63T, E65D, L89M  
>CU78| codons 1-99
PQITLWQRPLVTVKIEGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QITIDICGHKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T215Y       V35T, T39L, I135A, S162C, K173I, Q174K, I178L, T200A, Q207E Y127H, F130L
>CU78| codons 1-221
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICLEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKHTALTIPSANNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRIKNPDLVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFYTPDKKH

References
Author Title Citation
Cuevas, MT High HIV-1 genetic diversity in Cuba. AIDS, 2002