<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
7DiBV 7DiBV60 U.S. 1995 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 NRTI+IDV 60

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82A, L90M L33I, G73S K14R, I62V, L63P, A71V, I93L  
>7DiBV60| 65 | codons 1-99 | clone 65
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVIEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKVISTVLVGPTPANIIGRNLMTQLGCTLNF
>7DiBV60| 66 | codons 1-99 | clone 66
PQITLWQRPIVTIRIGGQLKEALLDTGADDTVIEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVPIEIRGHKVISTVLVGPTPANIIGRNLMTQLGCTLNF
>7DiBV60| 67 | codons 1-99 | clone 67
PQITLWQRPIVTIRIGGQLKEALLDTGADDTVIEEINLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKVISTVLVGPTPANIIGRNLMTQLGCTLNF
>7DiBV60| 68 | codons 1-99 | clone 68
PQITLWQRPIVTIRIGGQLKEALLDTGADDTVIEEINLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKVISTVLVGPTPANIIGRNLMTQLGCTLNF
>7DiBV60| 69 | codons 1-99 | clone 69
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVIEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKVISTVLVGPTPANIIGRNLMTQLGCTLNF
>7DiBV60| 70 | codons 1-99 | clone 70
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVIEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKVISTVLVGPTPANIIGRNLMTQLGCTLNF
>7DiBV60| 72 | codons 1-99 | clone 72
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVIEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKVISTVLVGPTPANIIGRNLMTQLGCTLNF
>7DiBV60| 73 | codons 1-99 | clone 73
PQTTLWQRPIVTVKIGGQLKEALLDTGADDTVIEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKVISTVLVGPTPANIIGRNLMTQLGCTLNF
>7DiBV60| 75 | codons 1-99 | clone 75
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVIEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKVISTVLVGPTPANIIGRNLMTQLGCTLNF
>7DiBV60| codons 1-99
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVIEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKVISTVLVGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Zhang, Y-M Drug resistance during indinavir therapy is caused by mutations in the protease gene and in its gag substrate cleavage sites. J Virol, 1997
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005