<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
7DiBV 7DiBV41 U.S. 1994 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 NRTI+IDV 41

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82A, L90M L33I, G73S L10I, I62V, L63P, A71V, I93L  
>7DiBV41| 21 | codons 1-99 | clone 21
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVIEEMNLPRRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKVISTVLVGPTPANIIGRNLMTQLGCTLNF
>7DiBV41| 22 | codons 1-99 | clone 22
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVIEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKVISTVLVGPTPANIIGRNLMTQLGCTLNF
>7DiBV41| 38 | codons 1-99 | clone 38
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKVISTVLVGPTPANIIGRNLMTQLGCTLNF
>7DiBV41| 40 | codons 1-99 | clone 40
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEINLPGRWKPKIIGGIGGFIKVRQYD
QVPIEICGHKVISTVLVGPTPANIIGRNLITQLGCTLNF
>7DiBV41| 43 | codons 1-99 | clone 43
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVIEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKVISTVLVGPTPANIIGRNLMTQLGCTLNF
>7DiBV41| 46 | codons 1-99 | clone 46
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVIEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKVISTVLVGPTPANIIGRNLMTQLGCTLNF
>7DiBV41| 47 | codons 1-99 | clone 47
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVIEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKVISTVLVGPTPANIIGRNLMTQLGCTLNF
>7DiBV41| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVIEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKVISTVLVGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Zhang, Y-M Drug resistance during indinavir therapy is caused by mutations in the protease gene and in its gag substrate cleavage sites. J Virol, 1997
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005