<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CU95 CU95 Cuba 1999 HIV1 D PBMC None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ IDV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, I15V, K20M, M36I, R41K, L63P, I64L, H69Q  
>CU95| codons 1-99
PQITLWQRPLVTVKVGGQLMEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIPLEICGQKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N K70S, T215E     V35T, T39A, E40D, K49R, V60I, K122E, I135T, S162C, E169D, D177E, T200A, Q207E F61C
>CU95| codons 1-221
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICADMEKEGKISRIGPENPYNTPI
CAIKKKNSTSWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFETPDKKH

References
Author Title Citation
Cuevas, MT High HIV-1 genetic diversity in Cuba. AIDS, 2002