<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CU97 CU97 Cuba 1999 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ SQV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G16E, E35D, N37S, I62V, L63A, V77I  
>CU97| codons 1-99
PQITLWQRPLVTIKIEGQLKEALLDTGADDTVLEDMSLPGRWKPKMIGGIGGFIKVRQYD
QVAIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R       K49R, V106I, D123E, E169D, I178L, T200A, E204K, Q207E, R211K, F214L  
>CU97| codons 1-220
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISRIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDLVI
YQYMDDLYVGSDLEIGQHRAKIEKLREHLLKWGLTTPDKK

References
Author Title Citation
Cuevas, MT High HIV-1 genetic diversity in Cuba. AIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005