<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
UK2095 UK2095 U.K. 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 SQV 52
2 DDI+ AZT+ SQV 12
3 IDV+ 3TC+ SQV 78
4 NFV+ DDI+ D4T 47
5 RTV+ NVP+ D4T+ SQV 30
6 LPV+ ABC+ D4T 98

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, M36I, H69K, L89M, I93L  
>UK2095| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70KR, T215TFIS K219E G190GA   K11KR, V35T, T39E, S48T, V60I, K122E, D123S, K173A, D177E, T200A, Q207G, R211K  
>UK2095| codons 1-234
PISPIETVPVRLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEIVI
YQYMDDLYVASDLEIGQHRAKIEELRGHLLKWGFSTPDEKHQKEPPFLWMGYEL

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005