<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
UK2088 UK2088 U.K. 2002 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 RTV+ 3TC+ AZT NA
2 3TC+ 3TC+ AZT NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y       K11T, K20R, V21I, V35T, T39G, V60I, K122E, D123N, I135T, E138A, I142V, K173S, D177E, V179I, T200A, I202V, Q207A  
>UK2088| codons 1-234
PISPIETVPVTLKPGMDGPRIKQWPLTEEKIKALTEICGELEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNATPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSQNPEIII
YQYVDDLYVGSDLEIGQHRAKVEELRAHLWRWGFYTPDKKHQKEPPFLWMGYEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82F   I13V, K14R, I15V, K20R, E35D, M36I, R41K, I62V, L63LP, H69K, T74TS, L89I L97LS
>UK2088| codons 1-99
PQITLWQRPLVTVRVGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QVPIEICGKKAIGSVLVGPTPFNIIGRNILTQIGCTSNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005