<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
M091 M091 Ethiopia 2010 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  Q58E I15V, M36L, L63P, H69K, V82I, L89M, I93L  
>M091| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEELNLPGRWKPKMIGGIGGFIKVREYD
QIPIEICGKKAIGTVLVGPTPINIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39E, K122E, D123S, I142S, A158S, K173A, Q174K, D177E, I178L, G196K, T200E, Q207A, V245Q, A272P, K275Q, Q278N, E291D, V292I, I293V  
>M091| codons 1-321
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGSRYQYNVLPQGWKGSPSIFQSSMTKILEPFRAKNPELVI
YQYMDDLYVGSDLEIKQHREKIEELRAHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIQVKNLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDP

References
Author Title Citation
Huruy, K Limited increase in primary HIV-1C drug resistance mutations in treatment nave individuals in Ethiopia. J Med Virol, 2015