<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
UK2055 UK2055 U.K. 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ SQV 141

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19T, E35D, M36I, N37NT, R41K, H69K, L89M, I93L  
>UK2055| codons 1-99
PQITLWQRPLVSIKVGGQTKEALLDTGADDTVLEDITLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184MV, T215TNSY       K20R, V21VI, V35T, E36A, T39E, S48T, K122E, D123N, I135IL, S162N, K173T, Q174K, D177E, T200A, Q207E, R211K  
>UK2055| codons 1-234
PISPIETVPVKLKPGMDGPRIKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRTKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGFYTPDKKHQKEPPFLWMGYEL

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005