<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
6HeBV 6HeBV44 U.S. 1994 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+IDV 44

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M   L10I, I15V, L63P, K70Q  
>6HeBV44| 37 | codons 1-99 | clone 37
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFVKVRQYD
QIPIEICGHQAIGTVLVGPTPANIIGRNLMTQIGCTLNF
>6HeBV44| 38 | codons 1-99 | clone 38
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFIKVRQYD
QIPIEICGHQAIGTVLVGPTPANIIGRNLMTQIGCTLNF
>6HeBV44| 39 | codons 1-99 | clone 39
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEEINLPGRWKPKLIGGIGGFVKVRQYD
QIPIEICGHQAIGTVLVGPTPANIIGRNMLTQIGCTLNF
>6HeBV44| 40 | codons 1-99 | clone 40
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEEINLPGRWKPKLIGGIGGFVKVRQYD
QIPIEICGHQAIGTVLVGPTPANIIGRNMLTQIGCTLNF
>6HeBV44| 41 | codons 1-99 | clone 41
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEEINLPGRWKPKLIGGIGGFVKVR*YD
QIPIEICGHQAIGTVLVGPTPANIIGRNLLTQIGCTLNF
>6HeBV44| 42 | codons 1-99 | clone 42
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEEINLPGRWKPKLIGGIGGFVKVRRYD
QIPIEICGHQAIGTVLVGPTPANIIGRNLLTQIGCTLNF
>6HeBV44| 43 | codons 1-99 | clone 43
PQITLRQRPIVTIKVGGQLKEALLDTGADDTVLEEINLPGRWKPKLIGGIGGFVKVRQYD
QIPIEICGHQAIGTVLVGPTPANIIGRNLLTQIGCTLNF
>6HeBV44| 44 | codons 1-99 | clone 44
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEEINLPGRWKPKLIGGIGGFVKVRQYD
QIPIEICGHQAIGTVLVGPTPANIIGRNLLTQIGCTLNF
>6HeBV44| 45 | codons 1-99 | clone 45
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEEINLPGRWKPKLIGGIGGFVKVRQYD
QIPIEICGHQAIGTVLVGPTPANIIGRNMLTQIGCTLNF
>6HeBV44| 46 | codons 1-99 | clone 46
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEEINLPGRWKPKLIGGIGGFVKVRQYD
QIPIEICGHQAIGTVLVGPTPANIIGRNMLTQIGCTLNF
>6HeBV44| codons 1-99
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFVKVRQYD
QIPIEICGHQAIGTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Zhang, Y-M Drug resistance during indinavir therapy is caused by mutations in the protease gene and in its gag substrate cleavage sites. J Virol, 1997
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005