<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
UK1447b UK1447b U.K. 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ IDV 25
2 AZT+ NFV+ 3TC 13
3 NFV+ AZT+ ABC+ EFV 43
4 DDI+ RTV+ SQV 65
5 3TC+ APV+ LPV+ RTV 29

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y K219R K103NS P225H V35T, T39E, S48T, V118VI, K122E, D123S, I135L, K173T, Q174K, T200A, Q207E, R211K, L228HR  
>UK1447b| codons 1-236
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEELEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DESFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGFYTPDRKHQKEHPFHWMGYELHP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I50V, I54V, V82A, L90M L10F, L23I, K43T I15V, K20R, E35D, M36I, R41K, I62V, L63V, H69K, A71V, T74S, L89I, I93L  
>UK1447b| codons 1-99
PQITLWQRPFVTIKVGGQLREAILDTGADDTVLEDINLPGKWTPKIIGGVGGFVKVRQYD
QVVIEICGKKVIGSVLVGPTPANIIGRNIMTQLGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005