<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
UK1979 UK1979 U.K. 2002 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ 3TC+ NFV NA
2 AZT+ 3TC NA
3 NVP+ 3TC+ AZT 40

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N V108I V35T, V60I, D121H, K122E, I135R, D177E, E203K, Q207E  
>UK1979| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
HEDFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRTKIKELREHLLRWGFTTPDKKHQKEPPFLW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N   I13V, I15V, E35D, M36I, R41K, L63P  
>UK1979| codons 1-99
PQITLWQRPLVTVKVGGQLKEALLDTGADNTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005