<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AH_17335 AH_17335 Spain 2000 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 AZT 62
2 AZT+ DDC 72
3 3TC+ RTV+ SQV 14
4 AZT+ RTV+ 3TC+ SQV NA
5 DDI+ D4T+ SQV+ NFV+ NVP 43
6 DDI+ RTV+ IDV+ D4T NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, E35D, M36T, R41K, I62V, L63P, H69Y  
>AH_17335| codons 1-99
PQITLWQRPLVSIKIGGQLKEALLDTGADDTVLEDTNLPGKWKPKMIGGIGGFIKVRQYD
QVPIEICGYKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Holguin, A High prevalence of HIV-1 subtype G and natural polymorphisms at the protease gene among HIV-infected immigrants in Madrid. AIDS, 2002