Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| AH_G7110 | AH_G7110 | Spain | 2002 | HIV1 | CRF02_AG | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | D4T+ 3TC | NA |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| L10I, I13V, K20I, M36I, R41K, C67G, H69K, I72M, L89M |
| >AH_G7110| codons 3-99 ITLWQRPIVTVKIGGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQI LIEIGGKKAMGTVLVGPTPVNIIGRNMLTQIGCTLNF |
References
| Author | Title | Citation |
| Holguin, A | High prevalence of HIV-1 subtype G and natural polymorphisms at the protease gene among HIV-infected immigrants in Madrid. | AIDS, 2002 |
| Holguin, A | Impact of frequent natural polymorphisms at the protease gene on the in vitro susceptibility to protease inhibitors in HIV-1 non-B subtypes. | J Clin Virol, 2004 |