Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| AH_R3620 | AH_R3620 | Spain | 2002 | HIV1 | G | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | None | NA |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| I13V, K14R, K20I, M36I, R41K, L63S, H69K, P79S, L89M | T80P |
| >AH_R3620| codons 1-99 PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD QISIEICGKKAIGTVLVGSPPVNIIGRNMLTQIGCTLNF |
References
| Author | Title | Citation |
| Holguin, A | High prevalence of HIV-1 subtype G and natural polymorphisms at the protease gene among HIV-infected immigrants in Madrid. | AIDS, 2002 |
| Holguin, A | Impact of frequent natural polymorphisms at the protease gene on the in vitro susceptibility to protease inhibitors in HIV-1 non-B subtypes. | J Clin Virol, 2004 |
| Holguin, A | Heterogeneous nature of HIV-1 recombinants spreading in Spain. | J Med Virol, 2005 |