<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AH_R2637 AH_R2637 Spain 2002 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13A, K14R, L19I, K20I, M36I, N37D, R41K, K43R, I64M, C67E, H69K, V82I, L89M  
>AH_R2637| codons 1-90
PQITLWQRPLVTARIGGQIIEALLDTGADDTVLEEIDLPGKWRPKMIGGIGGFIKVRQYD
QILMEIEGKKAIGTVLVGPTPINIIGRNML

References
Author Title Citation
Holguin, A High prevalence of HIV-1 subtype G and natural polymorphisms at the protease gene among HIV-infected immigrants in Madrid. AIDS, 2002