<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
11ZALS065 11ZALS065 South Africa 2011 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC|D4T|NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67DN, K70KR, M184V   V106A F227L K20R, V35T, T39E, S48T, V60I, K122E, D123N, I135V, E138A, S162SC, K173T, Q174R, T200A, I202IV, Q207A, R211K, F214L, H221HY, V245Q, E248D, D250E, A272P, K275R, K277R, Q278H, L283I, T286A, E291D, V292I, I293V, E297K, L310I, V317A, I326V  
>11ZALS065| codons 1-328
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSATVLDVGDAYFSVPL
DENFRKYTAFTIPSVNNATPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRTRNPDIVI
YQYVDDLYVGSDLEIGQHRAKVEELRAHLLKWGLTTPDKKYQKEPPLLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIRVRHLCKLIRGAKALTDIVPLTKEAE
LELAENREIIKEPVHGAYYDPSKDLVAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    Q2K, T4P, T12P, I15V, G16R, L19I, E35D, M36I, N37D, L38F, R41K, D60E, Q61E, H69K, L89M, I93L P1L
>11ZALS065| codons 1-99
LKIPLWQRPLVPIKVRGQIKEALLDTGADDTVLEDIDFPGKWKPKMIGGIGGFIKVRQYE
EILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Skhosana, L High Prevalence of the K65R Mutation in HIV-1 Subtype C Infected Patients Failing Tenofovir-Based First-Line Regimens in South Africa. PLoS ONE, 2015