<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
11ZALS019 11ZALS019 South Africa 2011 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC|EFV|TDF NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74I, M184V   K103N, V106M F227L V35T, E36A, T39E, S48T, V60I, K101Q, K122E, K173A, Q174K, D177E, T200A, Q207E, R211K, V245Q, E248D, A272P, K277R, T286A, E291D, V292I, E297K  
>11ZALS019| codons 1-308
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKIVDFRELNKRTQDFWEVQLGIPHPAGLQKNKSMTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPLLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIIPLTKEAE
LELAENRE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, G16E, Q18H, L19I, K20T, M36I, R41K, D60E, L63Q, H69K, A71T, L89I, I93L  
>11ZALS019| codons 1-99
PQITLWQRPLVSIKVEGHITEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYE
QIQIEICGKKTIGTVLVGPTPVNIIGRNILTQLGCTLNF

References
Author Title Citation
Skhosana, L High Prevalence of the K65R Mutation in HIV-1 Subtype C Infected Patients Failing Tenofovir-Based First-Line Regimens in South Africa. PLoS ONE, 2015