<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12ZALS156 12ZALS156 South Africa 2012 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC|D4T|NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, T215Y V75I V106M K101H, F227L K20R, L34I, V35T, T39E, L109I, K122E, D123S, E138A, S162C, K173A, Q174K, D177E, V179I, T200A, I202T, Q207D, R211K, H221Y, V245Q, E248N, D250E, A272P, K275R, E291D, V292I, I293V, V314A, Q334N, G335D, R356K, M357T, G359T, K366R, A376AST, T377Q, S379C, K390R, A400T, E404D, K431T  
>12ZALS156| codons 1-434
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKAITEICEELEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLIDFRELNKRTQDFWEVQLGIPHPAGLHKKKSMTVIDVGDAYFSVPL
DESFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRAKNPEIII
YQYVDDLYVGSDLEIGQHRAKTEELRDHLLKWGFYTPDKKYQKEPPLLWMGYELHPDKWT
VQPIQLPNKESWTVNDIQKLVGKLNWASQIYPGIRVKQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPAHGVYYDPSKDLIAEIQKQGNDQWTYQIYQEPFKNLKTGKYAKTRTA
HTNDVRQLTEAVQKITQECIVIWGKTPKFRLPIQKETWETWWTDYWQATWIPEWEFVNTP
PLVKLWYQLETEPI

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19I, E35D, M36I, R41K, H69K, T74S, L89M, I93L  
>12ZALS156| codons 1-99
PQITLWQRPLVTIKVGGQIKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGSVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Skhosana, L High Prevalence of the K65R Mutation in HIV-1 Subtype C Infected Patients Failing Tenofovir-Based First-Line Regimens in South Africa. PLoS ONE, 2015