<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
5MuBV 5MuBV59 U.S. 1995 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 NRTI+IDV 59

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A L24I K14R, R41K, K55R, A71V, I93L  
>5MuBV59| 10 | codons 1-99 | clone 10
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKSKLIGGIGGFVKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLLTQLGCTLNF
>5MuBV59| 11 | codons 1-99 | clone 11
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPEKWKPKLIGGIGGFVQVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF
>5MuBV59| 12 | codons 1-99 | clone 12
PQITLWQRPLVTIRIGGQLKEALIDTGADDTVLEEMNLPGKWKPKIIGGIGGFVKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLLTQLGCTLNF
>5MuBV59| 13 | codons 1-99 | clone 13
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGK*KPKLIGGIGGFVKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF
>5MuBV59| 14 | codons 1-99 | clone 14
PQITLWQRPLVTIRIGGQLKEALIDTGADDTVLEEMNLPGKWKPKIIGGIGGFVRVRQYD
QIPIEICGHKVIGTVLVGPTPVNIIGRNLLTQLGCTLNF
>5MuBV59| 16 | codons 1-99 | clone 16
PQITLWQRPIVTIRIGGQLKEALIDTGADDTVLEEMNLPGKWKPKIIGGIGGFVRVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLLTQLGCTLNF
>5MuBV59| 45 | codons 1-99 | clone 45
PQITLWQRPLVTIRIGGQLKEALIDTGADDTVLEEMNLPGKWKPKIIGGIGGFVRVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLLTQLGCTLNF
>5MuBV59| 47 | codons 1-99 | clone 47
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKLIGGIGGFVKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLLTQLGCTLNF
>5MuBV59| 49 | codons 1-99 | clone 49
PQITLWQRPIVTIRIGGQLKEALIDTGADDTVLEEMNLPGKWKPKIIGGIGGFVRVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLLTQLGCTLNF
>5MuBV59| 50 | codons 1-99 | clone 50
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKLIGGIGGFVKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLLTQLGCTLNF
>5MuBV59| codons 1-99
PQITLWQRPLVTIRIGGQLKEALIDTGADDTVLEEMNLPGKWKPKIIGGIGGFVRVRQYD
QILIEICGHKVIGTVLVGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Zhang, Y-M Drug resistance during indinavir therapy is caused by mutations in the protease gene and in its gag substrate cleavage sites. J Virol, 1997
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005