<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PW_UG477 PW_UG477b Uganda 1998 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT 34
2 AZT+ DDI 10
3 AZT+ 3TC+ SQV 73

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K20R, M36I, R41K, Q61E, H69K, K70KE, L89M, I93L  
>PW_UG477b| codons 1-99
PQITLWQRPLVTIKIGGQLREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
EILIEICGKEAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184MV       V35T, E36EA, T39E, K122E, D123GS, I142V, K173A, D177E, T200A, I202V, Q207E, V245Q, A272P, I274IV, T286A, E291D, V292I, I293V, I329IV, Q334HN, G335D, R356K, M357R, G359AT, T377Q, K390R, A400AT K277V
>PW_UG477b| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEIVI
YQYVDDLYVGSDLEIGQHRAKVEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGVKVVQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQGHDQWTYQIYQEPFKNLKTGKYAKRRAA
HTNDVKQLTEAVQKIAQESIVIWGKTPKFRLPIQKETWET

References
Author Title Citation
Weidle, PJ Resistance to antiretroviral therapy among patients in Uganda. JAIDS, 2001