<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
5MuBV 5MuBV54 U.S. 1994 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 NRTI+IDV 54

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A   K14R, R41K, L63P, A71V, I93L  
>5MuBV54| 62 | codons 1-99 | clone 62
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKLIGGIGGFVKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLLTQLGCTLNF
>5MuBV54| 63 | codons 1-99 | clone 63
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKLIGGIGGFVKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLLTQLGCTLNF
>5MuBV54| 64 | codons 1-99 | clone 64
PQITLWQRPIVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKLIGGIGGFVKVRQYD
QIPIEICGHKAIGTVLVGPTPANIIGRNLLTQLGCTLNF
>5MuBV54| 65 | codons 1-99 | clone 65
PQITLWQRPIVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKLIGGIGGFVKVRQYD
QIPIEICGHKAIGTVLVGPTPANIIGRNLLTQLGCTLNF
>5MuBV54| 66 | codons 1-99 | clone 66
PQITLWQRPIVTIRIGGQLKEALIDTGADDTVLEEMNLPGKWKPKIIGGIGGFVKVRQYD
QIPVEICGHKTIGTVLVGPTPANIIGRNLLTQLGCTLNF
>5MuBV54| 68 | codons 1-99 | clone 68
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKLIGGIGGFVKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLLTQLGCTLNF
>5MuBV54| 69 | codons 1-99 | clone 69
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKLIGGIGGFVKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLLTQLGCTLNF
>5MuBV54| 70 | codons 1-99 | clone 70
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKLIGGIGGFVKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLLTQLGCTLNF
>5MuBV54| 72 | codons 1-99 | clone 72
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKLIGGIGGFVKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLLTQLGCTLNF
>5MuBV54| codons 1-99
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKLIGGIGGFVKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Zhang, Y-M Drug resistance during indinavir therapy is caused by mutations in the protease gene and in its gag substrate cleavage sites. J Virol, 1997
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005