<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PW_UG471 PW_UG471a Uganda 1998 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None 52
2 D4T+ 3TC+ SQV 13

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G16E, K20R, E35D, M36I, R41K, R57K, H69K, K70R, L89M  
>PW_UG471a| codons 1-99
PQITLWQRPLVTVKIEGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       K20R, V21I, V35T, T39K, K43D, K122E, D123N, K173S, D177E, V179I, I202V, Q207A, R211K, V245Q, E248D, T286A, E291D, V292I, I293V, E312D, V317A, I326V, G335D, M357K, G359S, K366R, T369A, A371V, I375V, A376T, T377M, A400T  
>PW_UG471a| codons 1-400
PISPIETVPVKLKPGMDGPRIKQWPLTEEKIKALTEICKEMEDEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSQNPEIII
YQYVDDLYVGSDLEIGQHRTKVEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKDPVHGAYYDPSKDLVAEIQKQGQDQWTYQIYQEPFKNLKTGKYARKRSA
HTNDVRQLAEVVQKVTMESIVIWGKTPKFKLPIQKETWET

References
Author Title Citation
Weidle, PJ Resistance to antiretroviral therapy among patients in Uganda. JAIDS, 2001
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005