<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PW_UG468 PW_UG468a Uganda 1998 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None 52
2 AZT+ 3TC 18

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       I31L, V35T, E36K, T39A, E40D, K46Q, K49R, V60I, D121Y, K122E, E169D, D177E, T200A, Q207E, V245Q, D250E, S251I, A272P, K277R, T286A, E291D, E297A, I329V, G335D, R356Q, M357R, T377R, K390R  
>PW_UG468a| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKLKALTKICADMEKEGQISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKEIWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDVIPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQGQDQWTYQIYQEPFKNLKTGKYAQRRGA
HTNDVKQLTEAVQKIARESIVIWGKTPKFRLPIQKETWEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L   V11A, G16E, K20R, M36I, I72T  
>PW_UG468a| codons 1-99
PQITLWQRPLATIKIEGQLREALLDTGADDTVLEEINLPGRWKPKLIGGIGGFIKVRQYD
QILIEICGHKATGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Weidle, PJ Resistance to antiretroviral therapy among patients in Uganda. JAIDS, 2001