<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
3062 3062_1 U.S. 2008 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None 52

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    D6E, E11D, S17N, V31I, L63I, L74I, E96D, L101I, T112V, T124N, T125A, G134N, K136T, E157Q, K160N, V201I, T206S, K211R, L234I, R269K S283G, D288N
>3062_1| codons 1-288
FLDGIEKAQEDHEKYHNNWRAMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQIDCTHLEGKIIIVAVHVASGYIEAEVIPAETGQDTAYFILKLAGRWPVKVIHTDNGSN
FTSNAVKAACWWANITQEFGIPYNPQSQGVVESMNKQLKNIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTRELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIKDYGKQMAGDDCVAGRQDEN

References
Author Title Citation
Molina, JM Efficacy and safety of once daily elvitegravir versus twice daily raltegravir in treatment-experienced patients with HIV-1 receiving a ritonavir-boosted protease inhibitor: randomised, double-blind, phase 3, non-inferiority study. Lancet Infect Dis, 2012