<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PW_UG454 PW_UG454a Uganda 1998 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None 52
2 3TC+ AZT 27

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V35T, E36A, T39E, E44D, S48T, K122E, D123S, I135X, A158S, E169ED, K173T, Q174K, D177E, T200A, R211K, V245Q, A272P, K277R, L283LI, E291D, V292I, I293V, G335D, R356K, G359T, T377LR, K390R  
>PW_UG454a| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKDGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSXNNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILDPFRTKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLIRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDVKQLTEAVQKIALESIVIWGKTPKFRLPIQKETWEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19IT, M36I, N37K, R41N, Q61N, E65D, H69K, L89M, I93L  
>PW_UG454a| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEEIKLPGNWKPKMIGGIGGFIKVRQYD
NILIDICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005
Weidle, PJ Resistance to antiretroviral therapy among patients in Uganda. JAIDS, 2001