<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PW_UG4399 PW_UG4399a Uganda 1998 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None 52
2 AZT+ 3TC+ RTV 69

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V35T, K122E, D123N, K173S, Q174K, D177E, V179I, Q207A, R211S, F214L, V241I, V245Q, D250E, A272T, V276I, I293V, P294A, E312N, D320E, G335D, M357R, G359S, A360V, A371V, A376V, V381I, A400T  
>PW_UG4399a| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEIII
YQYVDDLYVGSDLEIGQHRTKIEELRAHLLSWGLTTPDKKHQKEPPFLWMGYELHPDKWT
IQPIQLPEKESWTVNDIQKLVGKLNWASQIYTGIKIKQLCKLLRGTKALTEVVALTEEAE
LELAENREILKNPVHGVYYEPSKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYARRRSV
HTNDVKQLTEVVQKIVTESIIIWGKTPKFKLPIQKETWET

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82A L33F L10V, I13V, K20R, E35D, M36I, R41K, R57K, C67Y, H69K, L89M  
>PW_UG4399a| codons 1-99
PQITLWQRPVVTVKIGGQLREALLDTGADDTVFEDINLPGKWKPKMIGGIGGFIKVKQYD
QILIEIYGKKAIGTVLVGPTPANIIGRNMLTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005
Weidle, PJ Resistance to antiretroviral therapy among patients in Uganda. JAIDS, 2001