<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PW_UG4397 PW_UG4397a Uganda 1999 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None 52
2 3TC+ AZT 90

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, K70KR, M184V N348NI   V108VI E6D, V35T, V60I, K122E, D123S, I135T, K173S, Q174K, D177E, V179I, G196GE, T200A, Q207K, R211S, F214FL, T215X, V245K, D250E, K275Q, T286A, E291D, V292VI, I293V, P294T, E312D, Q334PS, G335D, K353KR, M357KQ, G359S, A360AT, T369X, A371AV, I375V, T377K, K390R, A400T  
>PW_UG4397a| codons 1-400
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELEKEGKISKIGPENPYNTPI
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTILDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEIII
YQYVDDLYVGSDLEIEQHRAKIEELRKHLLSWGLXTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKESWTVNDIQKLVGKLNWASQIYAGIQVKQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKDPVHGVYYDPSKDLIAEIQKQGPDQWTYQIYQEPFKILKTGRYARKRST
HTNDVKQLXEVVQKVAKESIVIWGKTPKFRLPIQKETWET

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, I15IV, G16GE, E35D, M36I, R41K, I62V, H69K, I72IM, L89M  
>PW_UG4397a| codons 1-99
PQITLWQRPLVTVKVEGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QVLIEICGKKAMGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005
Weidle, PJ Resistance to antiretroviral therapy among patients in Uganda. JAIDS, 2001