<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
97TZ08 97TZ08 Tanzania 1997 HIV1 C PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I13V, I15V, L19V, M36I, R41K, L63S, H69K, L89M, I93L  
>97TZ08| codons 1-99
PQITLWQRPLVSVKVGGQVKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QISIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        L34I, V35T, K49R, V60I, K122E, I142L, K173A, T200A, Q207E, V245Q, E248D, D250E, A272S, K277R, T286A, E291D, V292I, I293V, V317A, G335D, F346H, R356K, R358K, G359T, A376S, T377H, S379C, K390R, A400T, E404D, E432D, V435I, L469I, T470S, Q480H, H483Y, L491S, S519N, I526V, K530R, A534S, A554S  
>97TZ08| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKAITEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGLRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYSGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGQDQWTYQIYQEPHKNLKTGKYAKMKTA
HTNDVKQLTEAVQKISHECIVIWGKTPKFRLPIQKETWETWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIIGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSISDTTNQKTELH
AIYLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLVKKERVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Hoelscher, M High proportion of unrelated HIV-1 intersubtype recombinants in the Mbeya region of southwest Tanzania. AIDS, 2001