<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
4MaBV 4MaBV55 U.S. 1994 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 NRTI+IDV 55

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A   L63P, A71V  
>4MaBV55| 49 | codons 1-99 | clone 49
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFVKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF
>4MaBV55| 50 | codons 1-99 | clone 50
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFVKVRQYD
QIPIEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF
>4MaBV55| 51 | codons 1-99 | clone 51
PQITLWQRPLVTIKIGGQLKEALLDTGADDTILEEMNLPGRWKPKLIGGIGGFIKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF
>4MaBV55| 54 | codons 1-99 | clone 54
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFVKVRQYD
QIPIEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF
>4MaBV55| 56 | codons 1-99 | clone 56
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFVKVRQYD
QIPIEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF
>4MaBV55| 57 | codons 1-99 | clone 57
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFVKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF
>4MaBV55| 83 | codons 1-99 | clone 83
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFVKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF
>4MaBV55| 85 | codons 1-99 | clone 85
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFVKVRQYD
QIPIEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF
>4MaBV55| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFVKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Zhang, Y-M Drug resistance during indinavir therapy is caused by mutations in the protease gene and in its gag substrate cleavage sites. J Virol, 1997
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005