<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NKU3006 NKU3006 Kenya 2001 HIV1 D PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20R, M36I, N37D, R41K, I64V, E65D, K70R  
>NKU3006| codons 1-99
PQITLWQRPLVTVKIGGQLREALLDTGADDTVLEEIDLPGKWKPKMIGGIGGFIKVRQYD
QILVDICGHRAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, S17N, M50L, I72V, T112V, I113V, T124A, T125A, V201I, T218I, L234I, D256E  
>NKU3006| codons 1-288
FLDGIDKAQEEHERYHNNWRAMASDFNLPPVVAKEIVASCDKCQLKGEALHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKVVHTDNGSN
FTSAAVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQIIKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Dowling, WE Forty-one near full-length HIV-1 sequences from Kenya reveal an epidemic of subtype A and A-containing recombinants. AIDS, 2002