<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AP_GR45 AP_GR45 Greece 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ IDV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L T215E     T69S, D123E, F171Y, I178M, R211K  
>AP_GR45| codons 41-242
LEKEGKISKIGPENPYNTPVFAIKKKDSSKWRKLVDFRELNKRTQDFWEVQLGIPHPAGL
KKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPYRKQNPDMVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFETPDKK
HQKEPPFLWMGYELHPDKWTVQ

References
Author Title Citation
Papa, A HIV-1 subtypes and circulating recombinant forms (CRFs) in Northern Greece. Virus Res, 2002