<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7978 CA28569 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT 21
2 SQV+ AZT+ 3TC 4
3 RTV+ AZT+ 3TC 4
4 IDV+ AZT+ 3TC 21
5 IDV+ DDI+ D4T 43
6 SQV+ RTV+ DDI+ D4T 80
7 EFV+ D4T+ APV+ 3TC 77

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46IL, I54L, V82T, L90M G73S, L89LV R8X, L10I, I62V, L63P, A71V, I85V, I93L L5LP
>CA28569| codons 1-99
PQITPWQXPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFLKVRQYD
QVPIEICGHKVISTVLVGPTPTNIVGRNVMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y V75M G190Q A98G E6ED, K43E, V60I, R83K, V118I, I135V, I178L, T200A, R211K, V245E, A272P  
>CA20064| codons 1-276
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEEEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLMDFRELNKKTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDLVI
YQYVDDLYVQSDLEIGQHRAKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKV

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003