<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IN_344 IN_344 U.S. 2010 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 RAL NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
T66TI Q146R L2I, K14R, S24N, V31I, S39R, L101I, T112I, I113L, T124N, T125A, K136Q, D167E, V201I, K211Q, N222K, L234I, I251L  
>IN_344| codons 1-288
FIDGIDKAQEEHERYHSNWRAMANDFNLPPIVAKEIVARCDKCQLKGEAMHGQVDCSPGI
WQLDCIHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKILHTDNGSN
FTSNAVKAACWWAGIQQEFGIPYNPRSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTQELQKQITKIQKFRVYYRDSRDPIWKGPAK
LLWKGEGAVVLQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Hurt, CB Resistance to HIV integrase strand transfer inhibitors among clinical specimens in the United States, 2009-2012. Clin Infect Dis, 2014