<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IN_1611 IN_1611 U.S. 2011 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 RAL NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
E138A, G140S, Q148H L68LV M50I, I72IV, I113V, T124N, T125A, M154L, D167E, V201I  
>IN_1611| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAIHGQVDCSPGI
WQLDCTHVEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSN
FTSNAVKAACWWAGIKQAFSIPYNPQSHGVVESLNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Hurt, CB Resistance to HIV integrase strand transfer inhibitors among clinical specimens in the United States, 2009-2012. Clin Infect Dis, 2014