<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IN_1904 IN_1904 U.S. 2012 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 RAL NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
Y143R T97A, G163R K14R, V31I, A38N, L45Q, I60M, I72V, T112V, I113V, T124A, T125A, V126F, G134N, I135V, K136N, D167E, V201I, L234V  
>IN_1904| codons 1-288
FLDGIDKAQEEHERYHSNWRAMASDFNLPPIVAKEIVNSCDKCQQKGEAMHGQVDCSPGM
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQEAAYFLLKLAGRWPVKVVHTDNGSN
FTSAAFKAACWWANVNQEFGIPRNPQSQGVVESMNKELKKIIRQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Hurt, CB Resistance to HIV integrase strand transfer inhibitors among clinical specimens in the United States, 2009-2012. Clin Infect Dis, 2014