<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RES484 RES484 South Africa 2011 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV 100
2 3TC+D4T+NVP 105

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V A62V K101E, V106M, G190A F227L I2IV, K20KR, V35T, T39E, S48E, L109I, E138A, K173A, Q174R, D177E, I178M, T200A, Q207A, R211K, L228R, P243T, V245Q, A272P, K277R, E291D, V292I, I293V  
>RES484| codons 1-300
PVSPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICEEMEKEGKIEKIGPENPYNTPV
FVIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSMTVIDVGDAYFSVPL
DKDFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRARNPEMVI
YQYVDDLYVASDLEIGQHRAKIEELRAHLLKWGFTTPDKKHQKEPPLRWMGYELHPDKWT
VQTIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTDIVPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, Q18L, L19T, M36I, R41K, K45R, L63P, H69K, L89M, I93L  
>RES484| codons 1-99
PQITLWQRPLVSIKVGGLTKEALLDTGADDTVLEEINLPGKWKPRMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Manasa, J High-levels of acquired drug resistance in adult patients failing first-line antiretroviral therapy in a rural HIV treatment programme in KwaZulu-Natal, South Africa. PLoS ONE, 2013