<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RES083 RES083 South Africa 2011 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV 200

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N, V106M F227L V35T, E36A, T39E, S48T, K102R, K122E, D123G, I135M, K173A, Q174K, D177E, G196K, T200A, Q207A, R211K, V245Q, A272P, K281R, T286A, E291D, V292I, I293V  
>RES083| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRNKSMTVLDVGDAYFSVPL
DEGFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIVI
YQYVDDLYVGSDLEIKQHRAKIEELRAHLLKWGFTTPDKKHQKEPPLLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGAKALTDIVPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19I, M36I, P39S, R41K, L63P, H69K, I93L  
>RES083| codons 1-99
PQITLWQRPLVTIKVGGQIKEALLDTGADDTVLEEINLSGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Manasa, J High-levels of acquired drug resistance in adult patients failing first-line antiretroviral therapy in a rural HIV treatment programme in KwaZulu-Natal, South Africa. PLoS ONE, 2013