<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RES232 RES232 South Africa 2011 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 83

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   V106M F227L P4S, K20R, V35T, T39K, S48T, V60I, K122E, D123S, T165V, K173T, Q174K, D177E, I178L, T200A, R211K, F214L, V245Q, A272P, K277R, T286A, E291D, V292I, I293V  
>RES232| codons 1-300
PISSIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICKEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSMTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMVKILEPFRTKNPELVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLKWGLTTPDKKHQKEPPLLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14T, L19T, K20R, M36I, N37D, H69K, L89M, I93L  
>RES232| codons 1-99
PQITLWQRPLVTITIGGQTREALLDTGADDTVLEEIDLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Manasa, J High-levels of acquired drug resistance in adult patients failing first-line antiretroviral therapy in a rural HIV treatment programme in KwaZulu-Natal, South Africa. PLoS ONE, 2013