<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MM-357136812 3571368121 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI|NNRTI|PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74I, M184V, T215Y V75M L100I, K103N   V35I, E44D, I135T, H221Y, A272S, I293V, E312D, R356K, M357R, A360T, A371V, A376V, T386A K13R
>3571368121| codons 1-400
PISPIETVPVKLRPGMDGPKVKQWPLTEEKIKALIEICTELEKDGKISKIGPENPYNTPV
FAIKKKDSTKWRKIMDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPDKKYQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKDPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYAKRRGT
HTNDVKQLTEVVQKIVTESIVIWGKAPKFKLPIQKETWEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M   L24F, M36I, N37D, I62V, L63P, A71V, I72V, T80TA, I93L  
>3571368121| codons 1-99
PQITLWQRPLVTIKIGGQLKEALFDTGADDTVLEEIDLPGRWKPKIIGGIGGFIKVRQYD
QVPIEICGHKVVGTVLVGPAPVNVIGRNLMTQLGCTLNF

References
Author Title Citation
Margot, NA Genotypic and phenotypic analyses of HIV-1 in antiretroviral-experienced patients treated with tenofovir DF. AIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005