<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MM-372736683 3727366831 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI|NNRTI|PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, N88S   L10I, I13V, E35D, N37D, D60E, I62V, L63P, I72V, V77I, I93L  
>3727366831| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEDMDLPGRWKPKIIGGIGGFIKVRQYE
QVPIEICGHKAVGTVLIGPTPVNIIGRSLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215Y K219Q     E6D, V35VA, R83RG, I135L, T200K, V245VM, I293V, E297Q, S322T, R356K, A360T, K390R, E399D  
>3727366831| codons 1-400
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALAEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKGTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRKKIEELRQHLLRWGFYTPDQKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTQEAE
LELAENREILKEPVHGVYYDPTKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYAKMRGT
HTNDVKQLTEAVQKIATESIVIWGKTPKFRLPIQKETWDA

References
Author Title Citation
Margot, NA Genotypic and phenotypic analyses of HIV-1 in antiretroviral-experienced patients treated with tenofovir DF. AIDS, 2002
Rhee, SY Distribution of human immunodeficiency virus type 1 protease and reverse transcriptase mutation patterns in 4,183 persons undergoing genotypic resistance testing. AAC, 2004