<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NRTI|NNRTI|PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y V75L, K219R K103N, G190A   V35VI, T39A, K43E, V60I, D123E, I135T, I142V, S162Y, V189VI, G196GE, E203A, R211K, H221Y, A288S, T290TA, V317A, I329IV, Q334D, G359S, A371T, S379C, K390R K102DN, D110DE
>4262368221| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAELEEEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLLDFRELNKRTQDFWEVQLGIPHPAGLKDNKSVTVLEVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDIVI
YQYMDDLYIASDLEIEQHRTKIAELRQHLWKWGFYTPDRKYQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKSLAEVIPLTEEAE
LELAENREILKEPVHGAYYDPSKDLIAEVQKQGDGQWTYQIYQEPFKNLKTGKYARMRSA
HTNDVKQLTETVQKIATECIVIWGKTPKFRLPIQKETWEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, L90M   L10LI, K20MI, E35EG, M36I, R41K, I62V, L63A, A71V, T74S, I93L  
>4262368221| codons 1-99
PQITLWQRPIVTIKIGGQLMEALLDTGADDTVLEGINLPGKWKPKMIGGIGGFVKVRQYD
QVAIEICGHKVIGSVLVGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Margot, NA Genotypic and phenotypic analyses of HIV-1 in antiretroviral-experienced patients treated with tenofovir DF. AIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005