<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MM-521236621 5212366211 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI|NNRTI|PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V     V179D K20R, V35I, R83K, I135T, E138A, T165I, E169D, G196E, I202V, Q207N, R211K, I293V, E297T, L310I, Q334L, P345Q, M357T, T386I, K390R  
>5212366211| codons 1-400
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNATPGIRYQYNVLPQGWKGSPAIFQSSMIKILDPFRKQNPDIDI
YQYVDDLYVGSDLEIEQHRTKVEELRNHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTTEAE
LELAENREIIKEPVHGVYYDPSKDLIAEIQKQGLGQWTYQIYQEQFKNLKTGKYARTRGA
HTNDVKQLTEAVQKIATESIVIWGKIPKFRLPIQKETWEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D E35D, M36I, R41K, K45R, L63P, I66V, V77I, I93L  
>5212366211| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADNTVLEDINLPGKWKPRMIGGIGGFIKVRQYD
QIPIEVCGHKAIGTVLIGPTPVNIIGRDLLTQLGCTLNF

References
Author Title Citation
Margot, NA Genotypic and phenotypic analyses of HIV-1 in antiretroviral-experienced patients treated with tenofovir DF. AIDS, 2002
Rhee, SY Distribution of human immunodeficiency virus type 1 protease and reverse transcriptase mutation patterns in 4,183 persons undergoing genotypic resistance testing. AAC, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005