<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MM-405036789 4050367891 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI|NNRTI|PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y   Y188L   K43KE, V118VI, D177DG, V179VI, T200A, R211K, T286A, E297A, D324E, I329L, Q334E, M357K, Q373QH, A376S, T386TI, K390R, E399D  
>4050367891| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPGIII
YQYVDDLLVGSDLEIGQHRAKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVIPLTAEAE
LELAENREILKEPVHGVYYDPSKELIAELQKQGEGQWTYQIYQEPFKNLKTGKYARKRGA
HTNDVKQLTEAVHKISTESIVIWGKIPKFRLPIQKETWDA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, I54V, L90M L10F, L33I, N88D I13V, E35D, M36I, I62IV, L63P, A71T, I72IT, I93L  
>4050367891| codons 1-99
PQITLWQRPFVTVKIGGQLKEALLDTGADNTVIEDINLPGRWKPKMIGGIGGFVKVRQYD
QVPIEICGHKTTGTVLVGPTPVNIIGRDLMTQLGCTLNF

References
Author Title Citation
Margot, NA Genotypic and phenotypic analyses of HIV-1 in antiretroviral-experienced patients treated with tenofovir DF. AIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005