<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MM-352136759 3521367591 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI|NNRTI|PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D L33V, E35D, M36I, R41K, L63P, I64V, V75I  
>3521367591| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADNTVVEDINLPGKWKPKMIGGIGGFIKVRQYD
QIPVEICGHKAIGTILVGPTPVNIIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V35T, I135T, I142T, R211K, V245K, I293V, D324E, I329V, G333E, T377R, S379C, K395R, E399D  
>3521367591| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGTRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKELIAEVQKQEQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEAVQKIARECIVIWGKTPKFKLPIQRETWDA

References
Author Title Citation
Margot, NA Genotypic and phenotypic analyses of HIV-1 in antiretroviral-experienced patients treated with tenofovir DF. AIDS, 2002
Rhee, SY Distribution of human immunodeficiency virus type 1 protease and reverse transcriptase mutation patterns in 4,183 persons undergoing genotypic resistance testing. AAC, 2004