<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MM-237536664 2375366641 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI|NNRTI|PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, N88S   L10I, I13V, K20I, L63P, T74S, V77I  
>2375366641| codons 1-99
PQITLWQRPIVTVKIGGQLIEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKAIGSVLIGPTPVNIIGRSLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q     T27S, V35LM, K43KTN, K49R, D123DE, V179VI, T200TA, Q207E, D218E, D250E, Q334C, M357T, A371T, K385R  
>2375366641| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLSEEKIKALLEICTEMETEGKISRIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYVDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPEQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGCGQWTYQIYQEPFKNLKTGKYARTRGA
HTNDVKQLTETVQKIATESIVIWGRTPKFKLPIQKETWEA

References
Author Title Citation
Margot, NA Genotypic and phenotypic analyses of HIV-1 in antiretroviral-experienced patients treated with tenofovir DF. AIDS, 2002
Rhee, SY Distribution of human immunodeficiency virus type 1 protease and reverse transcriptase mutation patterns in 4,183 persons undergoing genotypic resistance testing. AAC, 2004